Foldit

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created: October 13, 2015
Expires: October 21, 2015 at 11:00 UTC
Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca²⁺ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca²⁺ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE