Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for egran48
    1. egran48 Lv 1
    100 pts. 9,324
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 99 pts. 9,278
  3. Avatar for mirp 3. mirp Lv 1 97 pts. 9,270
  4. Avatar for gloverd 4. gloverd Lv 1 95 pts. 9,268
  5. Avatar for bertro 5. bertro Lv 1 93 pts. 9,258
  6. Avatar for frood66 6. frood66 Lv 1 92 pts. 9,250
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 90 pts. 9,240
  8. Avatar for johnmitch 8. johnmitch Lv 1 88 pts. 9,236
  9. Avatar for viosca 9. viosca Lv 1 87 pts. 9,234
  10. Avatar for LociOiling 10. LociOiling Lv 1 85 pts. 9,230

Comments