Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Friday Lab 21. Friday Lab 1 pt. 8,183
  2. Avatar for CureCoin 22. CureCoin 1 pt. 8,150
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 8,145
  4. Avatar for Deleted group 24. Deleted group pts. 8,103
  5. Avatar for EVHS AP Biology 25. EVHS AP Biology 1 pt. 7,868
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,202

  1. Avatar for gloverd
    1. gloverd Lv 1
    100 pts. 9,328
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 90 pts. 9,328
  3. Avatar for mirp 3. mirp Lv 1 80 pts. 9,325
  4. Avatar for Paulo Roque 4. Paulo Roque Lv 1 71 pts. 9,322
  5. Avatar for actiasluna 5. actiasluna Lv 1 63 pts. 9,301
  6. Avatar for Blipperman 6. Blipperman Lv 1 55 pts. 9,295
  7. Avatar for ManVsYard 7. ManVsYard Lv 1 49 pts. 9,289
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 43 pts. 9,287
  9. Avatar for frood66 9. frood66 Lv 1 37 pts. 9,284
  10. Avatar for smilingone 10. smilingone Lv 1 32 pts. 9,278

Comments