Foldit

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created: October 13, 2015
Expires: October 21, 2015 at 11:00 UTC
Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca²⁺ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca²⁺ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE