Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Go Science 100 pts. 9,328
  2. Avatar for Gargleblasters 2. Gargleblasters 82 pts. 9,301
  3. Avatar for Beta Folders 3. Beta Folders 66 pts. 9,278
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 53 pts. 9,259
  5. Avatar for Contenders 5. Contenders 42 pts. 9,208
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 33 pts. 9,185
  7. Avatar for Russian team 7. Russian team 26 pts. 9,096
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,069
  9. Avatar for Deleted group 9. Deleted group pts. 9,062
  10. Avatar for HMT heritage 10. HMT heritage 11 pts. 9,046

  1. Avatar for Satina 141. Satina Lv 1 3 pts. 8,639
  2. Avatar for navn 142. navn Lv 1 3 pts. 8,626
  3. Avatar for GreekCivilization 143. GreekCivilization Lv 1 3 pts. 8,625
  4. Avatar for cassandraberry81897 144. cassandraberry81897 Lv 1 3 pts. 8,624
  5. Avatar for Auntecedent 145. Auntecedent Lv 1 3 pts. 8,623
  6. Avatar for decbin 146. decbin Lv 1 3 pts. 8,622
  7. Avatar for Colostomy EXPLOSION. 147. Colostomy EXPLOSION. Lv 1 3 pts. 8,621
  8. Avatar for marie.p 148. marie.p Lv 1 3 pts. 8,620
  9. Avatar for Jajaboman 149. Jajaboman Lv 1 3 pts. 8,615
  10. Avatar for ViJay7019 150. ViJay7019 Lv 1 3 pts. 8,611

Comments