Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Go Science 100 pts. 9,328
  2. Avatar for Gargleblasters 2. Gargleblasters 82 pts. 9,301
  3. Avatar for Beta Folders 3. Beta Folders 66 pts. 9,278
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 53 pts. 9,259
  5. Avatar for Contenders 5. Contenders 42 pts. 9,208
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 33 pts. 9,185
  7. Avatar for Russian team 7. Russian team 26 pts. 9,096
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,069
  9. Avatar for Deleted group 9. Deleted group pts. 9,062
  10. Avatar for HMT heritage 10. HMT heritage 11 pts. 9,046

  1. Avatar for Anrie 201. Anrie Lv 1 1 pt. 8,256
  2. Avatar for trentis1 202. trentis1 Lv 1 1 pt. 8,250
  3. Avatar for mrmojo42 203. mrmojo42 Lv 1 1 pt. 8,244
  4. Avatar for parsnip 204. parsnip Lv 1 1 pt. 8,237
  5. Avatar for NotJim99 205. NotJim99 Lv 1 1 pt. 8,230
  6. Avatar for LanceKitchen 206. LanceKitchen Lv 1 1 pt. 8,228
  7. Avatar for thegr8guitar 207. thegr8guitar Lv 1 1 pt. 8,226
  8. Avatar for cnhrcolemam 208. cnhrcolemam Lv 1 1 pt. 8,225
  9. Avatar for LordDeathwing 209. LordDeathwing Lv 1 1 pt. 8,216
  10. Avatar for fishercat 210. fishercat Lv 1 1 pt. 8,205

Comments