Placeholder image of a protein
Icon representing a puzzle

1149: Revisiting Puzzle 95: Chicken

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 13, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,328
  2. Avatar for Gargleblasters 2. Gargleblasters 82 pts. 9,301
  3. Avatar for Beta Folders 3. Beta Folders 66 pts. 9,278
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 53 pts. 9,259
  5. Avatar for Contenders 5. Contenders 42 pts. 9,208
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 33 pts. 9,185
  7. Avatar for Russian team 7. Russian team 26 pts. 9,096
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,069
  9. Avatar for Deleted group 9. Deleted group pts. 9,062
  10. Avatar for HMT heritage 10. HMT heritage 11 pts. 9,046
  1. Avatar for Deleted player 21. Deleted player pts. 9,164
  2. Avatar for KarenCH 22. KarenCH Lv 1 68 pts. 9,162
  3. Avatar for grogar7 23. grogar7 Lv 1 66 pts. 9,162
  4. Avatar for smilingone 24. smilingone Lv 1 65 pts. 9,153
  5. Avatar for nemo7731 25. nemo7731 Lv 1 64 pts. 9,150
  6. Avatar for gitwut 26. gitwut Lv 1 63 pts. 9,147
  7. Avatar for g_b 27. g_b Lv 1 61 pts. 9,143
  8. Avatar for WonkyDonkey 28. WonkyDonkey Lv 1 60 pts. 9,139
  9. Avatar for WarpSpeed 29. WarpSpeed Lv 1 59 pts. 9,138
  10. Avatar for jobo0502 30. jobo0502 Lv 1 58 pts. 9,134

Comments