Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for Jim Fraser 91. Jim Fraser Lv 1 14 pts. 8,736
  2. Avatar for Truncheon Luncheon 92. Truncheon Luncheon Lv 1 14 pts. 8,732
  3. Avatar for drumpeter18yrs9yrs 93. drumpeter18yrs9yrs Lv 1 14 pts. 8,731
  4. Avatar for t012 94. t012 Lv 1 13 pts. 8,729
  5. Avatar for Mark A 95. Mark A Lv 1 13 pts. 8,708
  6. Avatar for 01010011111 96. 01010011111 Lv 1 13 pts. 8,708
  7. Avatar for nicobul 97. nicobul Lv 1 12 pts. 8,696
  8. Avatar for pmthomson90 98. pmthomson90 Lv 1 12 pts. 8,694
  9. Avatar for Glen B 99. Glen B Lv 1 12 pts. 8,693
  10. Avatar for alwen 100. alwen Lv 1 11 pts. 8,687

Comments