1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Summary

• Created: October 21, 2015
• Expires: October 28, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

• 1. Contenders 100 pts. 9,385
• 2. Go Science 81 pts. 9,380
• 3. Gargleblasters 65 pts. 9,343
• 4. Beta Folders 52 pts. 9,341
• 5. Anthropic Dreams 41 pts. 9,300
• 6. Void Crushers 32 pts. 9,258
• 7. HMT heritage 24 pts. 9,242
• 8. L'Alliance Francophone 18 pts. 9,209
• 9. Italiani Al Lavoro 14 pts. 9,120
• 10. Deleted group pts. 9,028

Top soloists

• 1. gitwut 100 pts. 9,384
• 2. pauldunn 99 pts. 9,368
• 3. LociOiling 97 pts. 9,341
• 4. mimi 95 pts. 9,315
• 5. mirp 93 pts. 9,314
• 6. grogar7 92 pts. 9,300
• 7. BitSpawn 90 pts. 9,279
• 8. Blipperman 88 pts. 9,278
• 9. Bruno Kestemont 87 pts. 9,272
• 10. viosca 85 pts. 9,268