Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for Arne Heessels 161. Arne Heessels Lv 1 2 pts. 7,993
  2. Avatar for pandabearsecond 162. pandabearsecond Lv 1 2 pts. 7,941
  3. Avatar for anderssundin 163. anderssundin Lv 1 2 pts. 7,923
  4. Avatar for jebbiek 164. jebbiek Lv 1 2 pts. 7,916
  5. Avatar for ncameron 165. ncameron Lv 1 2 pts. 7,909
  6. Avatar for gldisater 166. gldisater Lv 1 2 pts. 7,908
  7. Avatar for ivalnic 167. ivalnic Lv 1 1 pt. 7,900
  8. Avatar for Auntecedent 168. Auntecedent Lv 1 1 pt. 7,897
  9. Avatar for tela 169. tela Lv 1 1 pt. 7,888
  10. Avatar for Iron pet 170. Iron pet Lv 1 1 pt. 7,875

Comments