Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for ErazorOne 171. ErazorOne Lv 1 1 pt. 7,873
  2. Avatar for riley_choi 172. riley_choi Lv 1 1 pt. 7,869
  3. Avatar for inkycatz 173. inkycatz Lv 1 1 pt. 7,863
  4. Avatar for forest124124 174. forest124124 Lv 1 1 pt. 7,859
  5. Avatar for Wheeler22 175. Wheeler22 Lv 1 1 pt. 7,855
  6. Avatar for Sydefecks 176. Sydefecks Lv 1 1 pt. 7,847
  7. Avatar for rinze 177. rinze Lv 1 1 pt. 7,845
  8. Avatar for senor pit 178. senor pit Lv 1 1 pt. 7,840
  9. Avatar for NotJim99 179. NotJim99 Lv 1 1 pt. 7,811
  10. Avatar for monkry 180. monkry Lv 1 1 pt. 7,810

Comments