Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for Inkedhands 181. Inkedhands Lv 1 1 pt. 7,798
  2. Avatar for leehaggis 182. leehaggis Lv 1 1 pt. 7,789
  3. Avatar for herballemon 183. herballemon Lv 1 1 pt. 7,787
  4. Avatar for Albatross795 184. Albatross795 Lv 1 1 pt. 7,782
  5. Avatar for ViJay7019 185. ViJay7019 Lv 1 1 pt. 7,757
  6. Avatar for dahast.de 186. dahast.de Lv 1 1 pt. 7,755
  7. Avatar for scubasteve1721 187. scubasteve1721 Lv 1 1 pt. 7,751
  8. Avatar for a5hm0r 188. a5hm0r Lv 1 1 pt. 7,723
  9. Avatar for AEJensen 189. AEJensen Lv 1 1 pt. 7,698
  10. Avatar for franse 190. franse Lv 1 1 pt. 7,696

Comments