Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359

  1. Avatar for Jaco van As 221. Jaco van As Lv 1 1 pt. 7,439
  2. Avatar for minkim2015 222. minkim2015 Lv 1 1 pt. 7,439
  3. Avatar for fabiodavilla 223. fabiodavilla Lv 1 1 pt. 7,428
  4. Avatar for agnairt 224. agnairt Lv 1 1 pt. 7,426
  5. Avatar for tryedward 225. tryedward Lv 1 1 pt. 7,426
  6. Avatar for xtek23x 226. xtek23x Lv 1 1 pt. 7,424
  7. Avatar for kyubu1 227. kyubu1 Lv 1 1 pt. 7,419
  8. Avatar for soyjesusortiz 228. soyjesusortiz Lv 1 1 pt. 7,417
  9. Avatar for benderm 229. benderm Lv 1 1 pt. 7,399
  10. Avatar for otong1 230. otong1 Lv 1 1 pt. 7,390

Comments