Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359

  1. Avatar for iankirk1098 231. iankirk1098 Lv 1 1 pt. 7,384
  2. Avatar for MatthewAcosta 232. MatthewAcosta Lv 1 1 pt. 7,365
  3. Avatar for smarthuman 233. smarthuman Lv 1 1 pt. 7,359
  4. Avatar for Close At Hand 234. Close At Hand Lv 1 1 pt. 7,358
  5. Avatar for heitorsampaio 235. heitorsampaio Lv 1 1 pt. 7,354
  6. Avatar for przemek112233 236. przemek112233 Lv 1 1 pt. 7,351
  7. Avatar for orch 237. orch Lv 1 1 pt. 7,351
  8. Avatar for Ronin-Sensei 238. Ronin-Sensei Lv 1 1 pt. 7,348
  9. Avatar for Krawallnikow 239. Krawallnikow Lv 1 1 pt. 7,322
  10. Avatar for Joshua Peay 240. Joshua Peay Lv 1 1 pt. 7,314

Comments