Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for blakitachi00 251. blakitachi00 Lv 1 1 pt. 7,049
  2. Avatar for Aldrovanda 252. Aldrovanda Lv 1 1 pt. 6,957
  3. Avatar for phi16 253. phi16 Lv 1 1 pt. 6,923
  4. Avatar for Igorogi 254. Igorogi Lv 1 1 pt. 6,893
  5. Avatar for Hongmiao Hu 255. Hongmiao Hu Lv 1 1 pt. 6,887
  6. Avatar for velvetzb 256. velvetzb Lv 1 1 pt. 6,822
  7. Avatar for EricTs 257. EricTs Lv 1 1 pt. 6,779
  8. Avatar for vagobe 258. vagobe Lv 1 1 pt. 6,731
  9. Avatar for Lub 259. Lub Lv 1 1 pt. 6,726
  10. Avatar for Chulzbabes 260. Chulzbabes Lv 1 1 pt. 6,568

Comments