Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 7 pts. 8,964
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,952
  3. Avatar for xkcd 13. xkcd 4 pts. 8,749
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 8,631
  5. Avatar for Russian team 15. Russian team 2 pts. 8,245
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 7,908
  7. Avatar for BCMB404-Fall2015 17. BCMB404-Fall2015 1 pt. 7,672
  8. Avatar for Alpha Folders 18. Alpha Folders 1 pt. 7,512
  9. Avatar for EVHS AP Biology 19. EVHS AP Biology 1 pt. 7,365
  10. Avatar for CureCoin 20. CureCoin 1 pt. 7,359
  1. Avatar for smilingone 61. smilingone Lv 1 30 pts. 8,948
  2. Avatar for YeshuaLives 62. YeshuaLives Lv 1 29 pts. 8,945
  3. Avatar for smholst 63. smholst Lv 1 28 pts. 8,942
  4. Avatar for stomjoh 64. stomjoh Lv 1 28 pts. 8,934
  5. Avatar for Soggy Doglog 65. Soggy Doglog Lv 1 27 pts. 8,913
  6. Avatar for Colostomy EXPLOSION. 66. Colostomy EXPLOSION. Lv 1 26 pts. 8,911
  7. Avatar for Pro Lapser 67. Pro Lapser Lv 1 26 pts. 8,904
  8. Avatar for jamiexq 68. jamiexq Lv 1 25 pts. 8,894
  9. Avatar for PrettyPony2001 69. PrettyPony2001 Lv 1 25 pts. 8,888
  10. Avatar for Crossed Sticks 70. Crossed Sticks Lv 1 24 pts. 8,881

Comments