Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,384
  2. Avatar for pauldunn 2. pauldunn Lv 1 99 pts. 9,368
  3. Avatar for LociOiling 3. LociOiling Lv 1 97 pts. 9,341
  4. Avatar for mimi 4. mimi Lv 1 95 pts. 9,315
  5. Avatar for mirp 5. mirp Lv 1 93 pts. 9,314
  6. Avatar for grogar7 6. grogar7 Lv 1 92 pts. 9,300
  7. Avatar for BitSpawn 7. BitSpawn Lv 1 90 pts. 9,279
  8. Avatar for Blipperman 8. Blipperman Lv 1 88 pts. 9,278
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 87 pts. 9,272
  10. Avatar for viosca 10. viosca Lv 1 85 pts. 9,268

Comments