Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437

  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,385
  2. Avatar for diamond_dust 2. diamond_dust Lv 1 88 pts. 9,380
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 77 pts. 9,379
  4. Avatar for gloverd 4. gloverd Lv 1 68 pts. 9,379
  5. Avatar for mimi 5. mimi Lv 1 59 pts. 9,376
  6. Avatar for mirp 6. mirp Lv 1 51 pts. 9,374
  7. Avatar for pauldunn 7. pauldunn Lv 1 44 pts. 9,373
  8. Avatar for TomTaylor 8. TomTaylor Lv 1 38 pts. 9,371
  9. Avatar for sheerbliss 9. sheerbliss Lv 1 32 pts. 9,369
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 27 pts. 9,357

Comments