Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Contenders 100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028

  1. Avatar for Deleted player 11. Deleted player pts. 9,353
  2. Avatar for ViJay7019 12. ViJay7019 Lv 1 20 pts. 9,346
  3. Avatar for actiasluna 13. actiasluna Lv 1 16 pts. 9,343
  4. Avatar for Blipperman 14. Blipperman Lv 1 14 pts. 9,343
  5. Avatar for Skippysk8s 15. Skippysk8s Lv 1 11 pts. 9,342
  6. Avatar for LociOiling 16. LociOiling Lv 1 9 pts. 9,334
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 8 pts. 9,334
  8. Avatar for smilingone 18. smilingone Lv 1 6 pts. 9,334
  9. Avatar for smholst 19. smholst Lv 1 5 pts. 9,329
  10. Avatar for brgreening 20. brgreening Lv 1 4 pts. 9,321

Comments