Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Contenders 100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028

  1. Avatar for phi16 31. phi16 Lv 1 1 pt. 9,263
  2. Avatar for Mark- 32. Mark- Lv 1 1 pt. 9,243
  3. Avatar for O Seki To 33. O Seki To Lv 1 1 pt. 9,242
  4. Avatar for bertro 34. bertro Lv 1 1 pt. 9,228
  5. Avatar for Deleted player 35. Deleted player 1 pt. 9,227
  6. Avatar for ManVsYard 36. ManVsYard Lv 1 1 pt. 9,207
  7. Avatar for nicobul 37. nicobul Lv 1 1 pt. 9,198
  8. Avatar for Museka 38. Museka Lv 1 1 pt. 9,198
  9. Avatar for Cyberkashi 39. Cyberkashi Lv 1 1 pt. 9,088
  10. Avatar for goastano 40. goastano Lv 1 1 pt. 9,074

Comments