Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028
  1. Avatar for ar3n 191. ar3n Lv 1 1 pt. 7,692
  2. Avatar for raafay 192. raafay Lv 1 1 pt. 7,672
  3. Avatar for ventus14 193. ventus14 Lv 1 1 pt. 7,668
  4. Avatar for kerpowah 194. kerpowah Lv 1 1 pt. 7,660
  5. Avatar for Gaouenn 195. Gaouenn Lv 1 1 pt. 7,649
  6. Avatar for Deleted player 196. Deleted player pts. 7,648
  7. Avatar for ChinaSESsolve 197. ChinaSESsolve Lv 1 1 pt. 7,645
  8. Avatar for Kim Jong-il 198. Kim Jong-il Lv 1 1 pt. 7,639
  9. Avatar for cassandraberry81897 199. cassandraberry81897 Lv 1 1 pt. 7,636
  10. Avatar for Tac1 200. Tac1 Lv 1 1 pt. 7,628

Comments