Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028
  1. Avatar for Mike Cassidy 261. Mike Cassidy Lv 1 1 pt. 6,525
  2. Avatar for Aurox15 262. Aurox15 Lv 1 1 pt. 6,147
  3. Avatar for CrowdSem15 263. CrowdSem15 Lv 1 1 pt. 6,133
  4. Avatar for wozzarelli 264. wozzarelli Lv 1 1 pt. 5,964
  5. Avatar for rozrabiaka133 265. rozrabiaka133 Lv 1 1 pt. 5,604
  6. Avatar for bbbrandon 266. bbbrandon Lv 1 1 pt. 2,437
  7. Avatar for jackie123 267. jackie123 Lv 1 1 pt. 2,437
  8. Avatar for Pyotr 268. Pyotr Lv 1 1 pt. 2,437
  9. Avatar for Leon C 269. Leon C Lv 1 1 pt. 2,437
  10. Avatar for Simek 270. Simek Lv 1 1 pt. 2,437

Comments