Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,865
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 99 pts. 9,861
  3. Avatar for Vredeman 3. Vredeman Lv 1 97 pts. 9,850
  4. Avatar for grogar7 4. grogar7 Lv 1 95 pts. 9,838
  5. Avatar for gitwut 5. gitwut Lv 1 93 pts. 9,830
  6. Avatar for BitSpawn 6. BitSpawn Lv 1 91 pts. 9,791
  7. Avatar for mimi 7. mimi Lv 1 89 pts. 9,760
  8. Avatar for Deleted player 8. Deleted player pts. 9,743
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 86 pts. 9,742
  10. Avatar for aznarog 10. aznarog Lv 1 84 pts. 9,734

Comments