Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 9,544
  2. Avatar for Russian team 12. Russian team 6 pts. 9,179
  3. Avatar for Natural Abilities 13. Natural Abilities 4 pts. 9,113
  4. Avatar for Deleted group 14. Deleted group pts. 8,822
  5. Avatar for xkcd 15. xkcd 2 pts. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 2 pts. 8,650
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,385
  8. Avatar for ASD folders 18. ASD folders 1 pt. 7,905
  9. Avatar for Hamber 2-2 1 19. Hamber 2-2 1 1 pt. 7,738
  10. Avatar for Mr. Baxley's Students 20. Mr. Baxley's Students 1 pt. 7,718
  1. Avatar for trebach 181. trebach Lv 1 1 pt. 8,072
  2. Avatar for JinniaFlyer450 182. JinniaFlyer450 Lv 1 1 pt. 8,069
  3. Avatar for crackenmeister 183. crackenmeister Lv 1 1 pt. 8,063
  4. Avatar for DScott 184. DScott Lv 1 1 pt. 8,058
  5. Avatar for skenig 185. skenig Lv 1 1 pt. 8,053
  6. Avatar for drumpeter18yrs9yrs 186. drumpeter18yrs9yrs Lv 1 1 pt. 7,925
  7. Avatar for Thebatman012 187. Thebatman012 Lv 1 1 pt. 7,925
  8. Avatar for herballemon 188. herballemon Lv 1 1 pt. 7,923
  9. Avatar for parsnip 189. parsnip Lv 1 1 pt. 7,918
  10. Avatar for Albatross795 190. Albatross795 Lv 1 1 pt. 7,918

Comments