Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 9,544
  2. Avatar for Russian team 12. Russian team 6 pts. 9,179
  3. Avatar for Natural Abilities 13. Natural Abilities 4 pts. 9,113
  4. Avatar for Deleted group 14. Deleted group pts. 8,822
  5. Avatar for xkcd 15. xkcd 2 pts. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 2 pts. 8,650
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,385
  8. Avatar for ASD folders 18. ASD folders 1 pt. 7,905
  9. Avatar for Hamber 2-2 1 19. Hamber 2-2 1 1 pt. 7,738
  10. Avatar for Mr. Baxley's Students 20. Mr. Baxley's Students 1 pt. 7,718

  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 68 pts. 9,664
  2. Avatar for O Seki To 22. O Seki To Lv 1 66 pts. 9,663
  3. Avatar for joremen 23. joremen Lv 1 65 pts. 9,660
  4. Avatar for mirp 24. mirp Lv 1 63 pts. 9,633
  5. Avatar for viosca 25. viosca Lv 1 62 pts. 9,633
  6. Avatar for jermainiac 26. jermainiac Lv 1 61 pts. 9,614
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 60 pts. 9,609
  8. Avatar for gmn 28. gmn Lv 1 58 pts. 9,609
  9. Avatar for Galaxie 29. Galaxie Lv 1 57 pts. 9,607
  10. Avatar for jobo0502 30. jobo0502 Lv 1 56 pts. 9,604

Comments