Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,903
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 90 pts. 9,892
  3. Avatar for gmn 3. gmn Lv 1 81 pts. 9,890
  4. Avatar for jamiexq 4. jamiexq Lv 1 72 pts. 9,884
  5. Avatar for lamoille 5. lamoille Lv 1 64 pts. 9,880
  6. Avatar for gloverd 6. gloverd Lv 1 57 pts. 9,864
  7. Avatar for diamond_dust 7. diamond_dust Lv 1 50 pts. 9,864
  8. Avatar for mirp 8. mirp Lv 1 44 pts. 9,862
  9. Avatar for Paulo Roque 9. Paulo Roque Lv 1 39 pts. 9,862
  10. Avatar for LociOiling 10. LociOiling Lv 1 34 pts. 9,861

Comments