Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for ecali 101. ecali Lv 1 9 pts. 8,981
  2. Avatar for SKSbell 102. SKSbell Lv 1 9 pts. 8,976
  3. Avatar for WarpSpeed 103. WarpSpeed Lv 1 9 pts. 8,966
  4. Avatar for WBarme1234 104. WBarme1234 Lv 1 9 pts. 8,947
  5. Avatar for vuvuvu 105. vuvuvu Lv 1 8 pts. 8,933
  6. Avatar for FreeFolder 106. FreeFolder Lv 1 8 pts. 8,910
  7. Avatar for andrewxc 107. andrewxc Lv 1 8 pts. 8,908
  8. Avatar for arginia 108. arginia Lv 1 8 pts. 8,903
  9. Avatar for egran48 109. egran48 Lv 1 7 pts. 8,895
  10. Avatar for Auntecedent 110. Auntecedent Lv 1 7 pts. 8,889

Comments