Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for Pro Lapser 111. Pro Lapser Lv 1 7 pts. 8,877
  2. Avatar for tallguy-13088 112. tallguy-13088 Lv 1 7 pts. 8,870
  3. Avatar for Bushman 113. Bushman Lv 1 6 pts. 8,863
  4. Avatar for pfeiffelfloyd 114. pfeiffelfloyd Lv 1 6 pts. 8,858
  5. Avatar for cherry39 115. cherry39 Lv 1 6 pts. 8,853
  6. Avatar for Amphimixus 116. Amphimixus Lv 1 6 pts. 8,822
  7. Avatar for zo3xiaJonWeinberg 117. zo3xiaJonWeinberg Lv 1 6 pts. 8,783
  8. Avatar for Jim Fraser 118. Jim Fraser Lv 1 6 pts. 8,763
  9. Avatar for xedr 119. xedr Lv 1 5 pts. 8,748
  10. Avatar for dahast.de 120. dahast.de Lv 1 5 pts. 8,747

Comments