Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for franse 191. franse Lv 1 1 pt. 7,917
  2. Avatar for Inkedhands 192. Inkedhands Lv 1 1 pt. 7,914
  3. Avatar for decbin 193. decbin Lv 1 1 pt. 7,913
  4. Avatar for AryehK 194. AryehK Lv 1 1 pt. 7,911
  5. Avatar for forttomato 195. forttomato Lv 1 1 pt. 7,905
  6. Avatar for lkyd34 196. lkyd34 Lv 1 1 pt. 7,894
  7. Avatar for NotJim99 197. NotJim99 Lv 1 1 pt. 7,887
  8. Avatar for Close At Hand 198. Close At Hand Lv 1 1 pt. 7,885
  9. Avatar for olek23c 199. olek23c Lv 1 1 pt. 7,884
  10. Avatar for LagMasterSam 200. LagMasterSam Lv 1 1 pt. 7,871

Comments