Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651

  1. Avatar for AEJensen 211. AEJensen Lv 1 1 pt. 7,740
  2. Avatar for DarrenChang 212. DarrenChang Lv 1 1 pt. 7,738
  3. Avatar for MrPey 213. MrPey Lv 1 1 pt. 7,718
  4. Avatar for cnhrcolemam 214. cnhrcolemam Lv 1 1 pt. 7,713
  5. Avatar for Akatosh 215. Akatosh Lv 1 1 pt. 7,712
  6. Avatar for Exonx 216. Exonx Lv 1 1 pt. 7,675
  7. Avatar for Ciccillo 217. Ciccillo Lv 1 1 pt. 7,662
  8. Avatar for Jaco van As 218. Jaco van As Lv 1 1 pt. 7,648
  9. Avatar for MatthewAcosta 219. MatthewAcosta Lv 1 1 pt. 7,633
  10. Avatar for smhirt 220. smhirt Lv 1 1 pt. 7,626

Comments