Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for Sterh 221. Sterh Lv 1 1 pt. 7,625
  2. Avatar for przemek112233 222. przemek112233 Lv 1 1 pt. 7,618
  3. Avatar for 01010011111 223. 01010011111 Lv 1 1 pt. 7,590
  4. Avatar for Gaouenn 224. Gaouenn Lv 1 1 pt. 7,578
  5. Avatar for BillNye769 225. BillNye769 Lv 1 1 pt. 7,578
  6. Avatar for Lumir 226. Lumir Lv 1 1 pt. 7,576
  7. Avatar for aspadistra 227. aspadistra Lv 1 1 pt. 7,573
  8. Avatar for chazzahc101 228. chazzahc101 Lv 1 1 pt. 7,557
  9. Avatar for zkm 229. zkm Lv 1 1 pt. 7,557
  10. Avatar for RestrictionEndoNykolease 230. RestrictionEndoNykolease Lv 1 1 pt. 7,530

Comments