Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for Lauche2015 231. Lauche2015 Lv 1 1 pt. 7,530
  2. Avatar for Anamfija 232. Anamfija Lv 1 1 pt. 7,499
  3. Avatar for Mimi555 233. Mimi555 Lv 1 1 pt. 7,482
  4. Avatar for AlessandroFerrando 234. AlessandroFerrando Lv 1 1 pt. 7,462
  5. Avatar for GenGF 235. GenGF Lv 1 1 pt. 7,425
  6. Avatar for smarthuman 236. smarthuman Lv 1 1 pt. 7,425
  7. Avatar for Aldrovanda 237. Aldrovanda Lv 1 1 pt. 7,422
  8. Avatar for skhilnani 238. skhilnani Lv 1 1 pt. 7,422
  9. Avatar for Tac1 239. Tac1 Lv 1 1 pt. 7,413
  10. Avatar for otong1 240. otong1 Lv 1 1 pt. 7,393

Comments