Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651

  1. Avatar for Lollo 251. Lollo Lv 1 1 pt. 6,312
  2. Avatar for Xingychen 252. Xingychen Lv 1 1 pt. 5,478
  3. Avatar for xvchhrth 253. xvchhrth Lv 1 1 pt. 5,214
  4. Avatar for jl.fellows 254. jl.fellows Lv 1 1 pt. 5,129
  5. Avatar for alpert 255. alpert Lv 1 1 pt. 4,960
  6. Avatar for uraganuu 256. uraganuu Lv 1 1 pt. 4,651
  7. Avatar for RicGray 257. RicGray Lv 1 1 pt. 4,651
  8. Avatar for PapaJonny99 258. PapaJonny99 Lv 1 1 pt. 4,651
  9. Avatar for OlekF 259. OlekF Lv 1 1 pt. 4,651
  10. Avatar for packer 260. packer Lv 1 1 pt. 4,651

Comments