Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651

  1. Avatar for WonkyDonkey 31. WonkyDonkey Lv 1 55 pts. 9,603
  2. Avatar for pvc78 32. pvc78 Lv 1 54 pts. 9,586
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 52 pts. 9,584
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 51 pts. 9,582
  5. Avatar for nemo7731 35. nemo7731 Lv 1 50 pts. 9,580
  6. Avatar for Museka 36. Museka Lv 1 49 pts. 9,574
  7. Avatar for silverberg 37. silverberg Lv 1 48 pts. 9,574
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 47 pts. 9,547
  9. Avatar for deLaCeiba 39. deLaCeiba Lv 1 46 pts. 9,544
  10. Avatar for hpaege 40. hpaege Lv 1 45 pts. 9,537

Comments