Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for johnmitch 41. johnmitch Lv 1 44 pts. 9,536
  2. Avatar for Blipperman 42. Blipperman Lv 1 43 pts. 9,536
  3. Avatar for reefyrob 43. reefyrob Lv 1 42 pts. 9,535
  4. Avatar for Crossed Sticks 44. Crossed Sticks Lv 1 41 pts. 9,517
  5. Avatar for gloverd 45. gloverd Lv 1 40 pts. 9,514
  6. Avatar for smilingone 46. smilingone Lv 1 39 pts. 9,513
  7. Avatar for goastano 47. goastano Lv 1 38 pts. 9,502
  8. Avatar for sheerbliss 48. sheerbliss Lv 1 37 pts. 9,500
  9. Avatar for Norrjane 49. Norrjane Lv 1 37 pts. 9,460
  10. Avatar for cbwest 50. cbwest Lv 1 36 pts. 9,454

Comments