Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for alwen 51. alwen Lv 1 35 pts. 9,453
  2. Avatar for KarenCH 52. KarenCH Lv 1 34 pts. 9,439
  3. Avatar for georg137 53. georg137 Lv 1 33 pts. 9,438
  4. Avatar for pmdpmd 54. pmdpmd Lv 1 32 pts. 9,433
  5. Avatar for Deleted player 55. Deleted player 32 pts. 9,430
  6. Avatar for stomjoh 56. stomjoh Lv 1 31 pts. 9,419
  7. Avatar for YeshuaLives 57. YeshuaLives Lv 1 30 pts. 9,411
  8. Avatar for gurch 58. gurch Lv 1 30 pts. 9,395
  9. Avatar for nicobul 59. nicobul Lv 1 29 pts. 9,389
  10. Avatar for dettingen 60. dettingen Lv 1 28 pts. 9,378

Comments