Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 7,633
  2. Avatar for Czech National Team 22. Czech National Team 1 pt. 7,576
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 7,573
  4. Avatar for Alpha Folders 24. Alpha Folders 1 pt. 7,530
  5. Avatar for CureCoin 25. CureCoin 1 pt. 7,425
  6. Avatar for ricg test group 26. ricg test group 1 pt. 4,651
  1. Avatar for Mohambone 61. Mohambone Lv 1 27 pts. 9,374
  2. Avatar for ponderosa 62. ponderosa Lv 1 27 pts. 9,360
  3. Avatar for uhuuhu 63. uhuuhu Lv 1 26 pts. 9,358
  4. Avatar for shettler 64. shettler Lv 1 25 pts. 9,356
  5. Avatar for Ernst Zundel 65. Ernst Zundel Lv 1 25 pts. 9,354
  6. Avatar for t012 66. t012 Lv 1 24 pts. 9,352
  7. Avatar for Paulo Roque 67. Paulo Roque Lv 1 24 pts. 9,342
  8. Avatar for sharondipity 68. sharondipity Lv 1 23 pts. 9,339
  9. Avatar for caglar 69. caglar Lv 1 22 pts. 9,328
  10. Avatar for Tweedle Dumb 70. Tweedle Dumb Lv 1 22 pts. 9,308

Comments