Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572

  1. Avatar for gitwut 21. gitwut Lv 1 6 pts. 9,831
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 5 pts. 9,822
  3. Avatar for mimi 23. mimi Lv 1 4 pts. 9,820
  4. Avatar for pauldunn 24. pauldunn Lv 1 4 pts. 9,820
  5. Avatar for Mark- 25. Mark- Lv 1 3 pts. 9,816
  6. Avatar for xedr 26. xedr Lv 1 2 pts. 9,814
  7. Avatar for phi16 27. phi16 Lv 1 2 pts. 9,778
  8. Avatar for hansvandenhof 28. hansvandenhof Lv 1 2 pts. 9,776
  9. Avatar for nicobul 29. nicobul Lv 1 1 pt. 9,771
  10. Avatar for TomTaylor 30. TomTaylor Lv 1 1 pt. 9,768

Comments