Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572

  1. Avatar for ErazorOne 151. ErazorOne Lv 1 2 pts. 8,422
  2. Avatar for SouperGenious 152. SouperGenious Lv 1 2 pts. 8,418
  3. Avatar for actin19 153. actin19 Lv 1 2 pts. 8,417
  4. Avatar for tarimo 154. tarimo Lv 1 2 pts. 8,415
  5. Avatar for bamh 155. bamh Lv 1 2 pts. 8,395
  6. Avatar for Savas 156. Savas Lv 1 2 pts. 8,385
  7. Avatar for JackONeill12 157. JackONeill12 Lv 1 2 pts. 8,383
  8. Avatar for atlas100 158. atlas100 Lv 1 1 pt. 8,382
  9. Avatar for leehaggis 159. leehaggis Lv 1 1 pt. 8,357
  10. Avatar for phi16 160. phi16 Lv 1 1 pt. 8,340

Comments