1153: Revisiting Puzzle 97: Pig
Closed since over 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- October 27, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
Top groups
-
100 pts. 9,903
-
-
-
-
-
-
-
-
-