Placeholder image of a protein
Icon representing a puzzle

1153: Revisiting Puzzle 97: Pig

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 27, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,903
  2. Avatar for Beta Folders 2. Beta Folders 82 pts. 9,865
  3. Avatar for Go Science 3. Go Science 66 pts. 9,864
  4. Avatar for Contenders 4. Contenders 53 pts. 9,831
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 42 pts. 9,771
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,735
  7. Avatar for FoldIt@Netherlands 7. FoldIt@Netherlands 26 pts. 9,700
  8. Avatar for Void Crushers 8. Void Crushers 20 pts. 9,684
  9. Avatar for HMT heritage 9. HMT heritage 15 pts. 9,664
  10. Avatar for Deleted group 10. Deleted group pts. 9,572

  1. Avatar for Blackhawk91 241. Blackhawk91 Lv 1 1 pt. 7,370
  2. Avatar for NameChangeNeeded01 242. NameChangeNeeded01 Lv 1 1 pt. 7,301
  3. Avatar for Cinamontoast 243. Cinamontoast Lv 1 1 pt. 7,298
  4. Avatar for scout89898 244. scout89898 Lv 1 1 pt. 7,292
  5. Avatar for Johnnywiki 245. Johnnywiki Lv 1 1 pt. 7,289
  6. Avatar for Dantoto 246. Dantoto Lv 1 1 pt. 7,249
  7. Avatar for mukmu 247. mukmu Lv 1 1 pt. 7,226
  8. Avatar for redrubi 248. redrubi Lv 1 1 pt. 7,001
  9. Avatar for Scopper 249. Scopper Lv 1 1 pt. 6,820
  10. Avatar for Dmitry Gavriley 250. Dmitry Gavriley Lv 1 1 pt. 6,599

Comments