Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 7,738
  2. Avatar for Deleted group 22. Deleted group pts. 7,733
  3. Avatar for OU CHEM4923 23. OU CHEM4923 1 pt. 7,696
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 7,568
  5. Avatar for 4j rgzh biology 25. 4j rgzh biology 1 pt. 7,491

  1. Avatar for smarthuman 211. smarthuman Lv 1 1 pt. 7,738
  2. Avatar for MemeMachine 212. MemeMachine Lv 1 1 pt. 7,735
  3. Avatar for 20521089 213. 20521089 Lv 1 1 pt. 7,733
  4. Avatar for reblok84 214. reblok84 Lv 1 1 pt. 7,727
  5. Avatar for haizerek 215. haizerek Lv 1 1 pt. 7,722
  6. Avatar for Pro Lapser 216. Pro Lapser Lv 1 1 pt. 7,722
  7. Avatar for eblee43 217. eblee43 Lv 1 1 pt. 7,696
  8. Avatar for akakebeen 218. akakebeen Lv 1 1 pt. 7,693
  9. Avatar for trebach 219. trebach Lv 1 1 pt. 7,691
  10. Avatar for zkm 220. zkm Lv 1 1 pt. 7,675

Comments