Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392
  1. Avatar for smarthuman 211. smarthuman Lv 1 1 pt. 7,738
  2. Avatar for MemeMachine 212. MemeMachine Lv 1 1 pt. 7,735
  3. Avatar for 20521089 213. 20521089 Lv 1 1 pt. 7,733
  4. Avatar for reblok84 214. reblok84 Lv 1 1 pt. 7,727
  5. Avatar for haizerek 215. haizerek Lv 1 1 pt. 7,722
  6. Avatar for Pro Lapser 216. Pro Lapser Lv 1 1 pt. 7,722
  7. Avatar for eblee43 217. eblee43 Lv 1 1 pt. 7,696
  8. Avatar for akakebeen 218. akakebeen Lv 1 1 pt. 7,693
  9. Avatar for trebach 219. trebach Lv 1 1 pt. 7,691
  10. Avatar for zkm 220. zkm Lv 1 1 pt. 7,675

Comments