Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392
  1. Avatar for parsnip 181. parsnip Lv 1 1 pt. 7,893
  2. Avatar for momadoc 182. momadoc Lv 1 1 pt. 7,893
  3. Avatar for martinf 183. martinf Lv 1 1 pt. 7,892
  4. Avatar for lflush 184. lflush Lv 1 1 pt. 7,885
  5. Avatar for cnhrcolemam 185. cnhrcolemam Lv 1 1 pt. 7,882
  6. Avatar for Mydogisa Toelicker 186. Mydogisa Toelicker Lv 1 1 pt. 7,881
  7. Avatar for ErazorOne 187. ErazorOne Lv 1 1 pt. 7,869
  8. Avatar for mirjamvandelft 188. mirjamvandelft Lv 1 1 pt. 7,856
  9. Avatar for Synthetic77 189. Synthetic77 Lv 1 1 pt. 7,848
  10. Avatar for optimumboo 190. optimumboo Lv 1 1 pt. 7,842

Comments