Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392
  1. Avatar for pauldunn 21. pauldunn Lv 1 68 pts. 8,438
  2. Avatar for Galaxie 22. Galaxie Lv 1 67 pts. 8,437
  3. Avatar for Jim Fraser 23. Jim Fraser Lv 1 65 pts. 8,436
  4. Avatar for gitwut 24. gitwut Lv 1 64 pts. 8,436
  5. Avatar for WonkyDonkey 25. WonkyDonkey Lv 1 63 pts. 8,433
  6. Avatar for Blipperman 26. Blipperman Lv 1 61 pts. 8,428
  7. Avatar for nicobul 27. nicobul Lv 1 60 pts. 8,427
  8. Avatar for diamond_dust 28. diamond_dust Lv 1 59 pts. 8,426
  9. Avatar for Vredeman 29. Vredeman Lv 1 58 pts. 8,422
  10. Avatar for aznarog 30. aznarog Lv 1 56 pts. 8,422

Comments