Placeholder image of a protein
Icon representing a puzzle

1154: Revisiting Puzzle 109: Pumpkin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 04, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 8,535
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,531
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 65 pts. 8,518
  4. Avatar for Go Science 4. Go Science 52 pts. 8,518
  5. Avatar for Contenders 5. Contenders 41 pts. 8,482
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 8,479
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,427
  8. Avatar for Deleted group 8. Deleted group pts. 8,398
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 14 pts. 8,398
  10. Avatar for Void Crushers 10. Void Crushers 10 pts. 8,392
  1. Avatar for smilingone 31. smilingone Lv 1 55 pts. 8,417
  2. Avatar for Mark- 32. Mark- Lv 1 54 pts. 8,415
  3. Avatar for frood66 33. frood66 Lv 1 53 pts. 8,413
  4. Avatar for cbwest 34. cbwest Lv 1 52 pts. 8,412
  5. Avatar for Paulo Roque 35. Paulo Roque Lv 1 51 pts. 8,411
  6. Avatar for g_b 36. g_b Lv 1 50 pts. 8,410
  7. Avatar for gloverd 37. gloverd Lv 1 49 pts. 8,407
  8. Avatar for joremen 38. joremen Lv 1 48 pts. 8,398
  9. Avatar for martin.szew 39. martin.szew Lv 1 46 pts. 8,398
  10. Avatar for Hiro Protagonist 40. Hiro Protagonist Lv 1 45 pts. 8,398

Comments