Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for Pibeagles 101. Pibeagles Lv 1 10 pts. 8,871
  2. Avatar for YeshuaLives 102. YeshuaLives Lv 1 10 pts. 8,870
  3. Avatar for ErazorOne 103. ErazorOne Lv 1 9 pts. 8,869
  4. Avatar for navn 104. navn Lv 1 9 pts. 8,863
  5. Avatar for alwen 105. alwen Lv 1 9 pts. 8,858
  6. Avatar for packer 106. packer Lv 1 9 pts. 8,854
  7. Avatar for deLaCeiba 107. deLaCeiba Lv 1 8 pts. 8,835
  8. Avatar for Superphosphate 108. Superphosphate Lv 1 8 pts. 8,832
  9. Avatar for pfirth 109. pfirth Lv 1 8 pts. 8,816
  10. Avatar for johngran 110. johngran Lv 1 8 pts. 8,816

Comments