Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for Truncheon Luncheon 141. Truncheon Luncheon Lv 1 3 pts. 8,630
  2. Avatar for ManVsYard 142. ManVsYard Lv 1 3 pts. 8,629
  3. Avatar for Festering Wounds 143. Festering Wounds Lv 1 3 pts. 8,627
  4. Avatar for guineapig 144. guineapig Lv 1 3 pts. 8,621
  5. Avatar for Mydogisa Toelicker 145. Mydogisa Toelicker Lv 1 2 pts. 8,619
  6. Avatar for Soggy Doglog 146. Soggy Doglog Lv 1 2 pts. 8,612
  7. Avatar for atlas100 147. atlas100 Lv 1 2 pts. 8,605
  8. Avatar for phi16 148. phi16 Lv 1 2 pts. 8,603
  9. Avatar for Simek 149. Simek Lv 1 2 pts. 8,599
  10. Avatar for Mr_Jolty 150. Mr_Jolty Lv 1 2 pts. 8,599

Comments