Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for Colostomy EXPLOSION. 151. Colostomy EXPLOSION. Lv 1 2 pts. 8,596
  2. Avatar for a5hm0r 152. a5hm0r Lv 1 2 pts. 8,594
  3. Avatar for Wheeler22 153. Wheeler22 Lv 1 2 pts. 8,575
  4. Avatar for NameChangeNeeded01 154. NameChangeNeeded01 Lv 1 2 pts. 8,570
  5. Avatar for pandabearsecond 155. pandabearsecond Lv 1 2 pts. 8,568
  6. Avatar for JackONeill12 156. JackONeill12 Lv 1 2 pts. 8,566
  7. Avatar for joui31 157. joui31 Lv 1 2 pts. 8,565
  8. Avatar for BCAA 158. BCAA Lv 1 2 pts. 8,557
  9. Avatar for lzhchild 159. lzhchild Lv 1 2 pts. 8,526
  10. Avatar for leehaggis 160. leehaggis Lv 1 2 pts. 8,521

Comments