1156: Revisiting Puzzle 110: Turkey
Closed since over 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- November 11, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
