Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for Wrath of Dan 211. Wrath of Dan Lv 1 1 pt. 7,969
  2. Avatar for franse 212. franse Lv 1 1 pt. 7,964
  3. Avatar for 20514392 213. 20514392 Lv 1 1 pt. 7,961
  4. Avatar for akakebeen 214. akakebeen Lv 1 1 pt. 7,959
  5. Avatar for chillprod 215. chillprod Lv 1 1 pt. 7,944
  6. Avatar for akii 216. akii Lv 1 1 pt. 7,940
  7. Avatar for subtlefox 217. subtlefox Lv 1 1 pt. 7,932
  8. Avatar for Carter J. Madsen 218. Carter J. Madsen Lv 1 1 pt. 7,926
  9. Avatar for cnhrcolemam 219. cnhrcolemam Lv 1 1 pt. 7,894
  10. Avatar for SarahSoward 220. SarahSoward Lv 1 1 pt. 7,889

Comments