Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for diamond_dust 21. diamond_dust Lv 1 68 pts. 9,198
  2. Avatar for bertro 22. bertro Lv 1 67 pts. 9,196
  3. Avatar for aznarog 23. aznarog Lv 1 65 pts. 9,194
  4. Avatar for Timo van der Laan 24. Timo van der Laan Lv 1 64 pts. 9,191
  5. Avatar for O Seki To 25. O Seki To Lv 1 63 pts. 9,186
  6. Avatar for Deleted player 26. Deleted player pts. 9,183
  7. Avatar for smilingone 27. smilingone Lv 1 60 pts. 9,178
  8. Avatar for nicobul 28. nicobul Lv 1 59 pts. 9,171
  9. Avatar for strong_base 29. strong_base Lv 1 58 pts. 9,165
  10. Avatar for Deleted player 30. Deleted player 57 pts. 9,164

Comments